PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00093635001
Common NameGSBRNA2T00093635001, LOC106386731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 245aa    MW: 27639.6 Da    PI: 8.1465
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00093635001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.31.6e-332177561
               zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          + cprC s+ntkfCyynnys+sqPry C++Crr+Wt+GGalr++P+Gg +rk k++
  GSBRNA2T00093635001 21 PRVCPRCSSDNTKFCYYNNYSVSQPRYNCRNCRRFWTHGGALRDIPIGGRARKIKRT 77
                         678**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-211676IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.6642276IPR003851Zinc finger, Dof-type
PfamPF027012.1E-302276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDKLSVIVKG DHQVNEEKPP PRVCPRCSSD NTKFCYYNNY SVSQPRYNCR NCRRFWTHGG  60
ALRDIPIGGR ARKIKRTSID QPSVSQVLSV VQQVNHHQPF LHAQETNEFL GTFGGAVGNH  120
FSSSPEIHGE MVLPIQSIPP MDRFDLFDVT FNQGYYGVGF NDLVGNPLMN QSIGGHVDNY  180
NSYRMNQEDP NNRNQSFNNS INMNHNTSTS GSRGYPGTDH MTDNNKDRNK CVFSSSYHLE  240
KYGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681996.10.0PREDICTED: dof zinc finger protein DOF4.4-like
RefseqXP_013594517.10.0PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA92e-74DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078JWI50.0A0A078JWI5_BRANA; BnaUnng03510D protein
TrEMBLA0A0D3A4Q50.0A0A0D3A4Q5_BRAOL; Uncharacterized protein
STRINGBra013493.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.13e-70Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]